SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9Z138 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C9Z138
Domain Number - Region: 77-152
Classification Level Classification E-value
Superfamily Prim-pol domain 0.0471
Family Bifunctional DNA primase/polymerase N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9Z138
Sequence length 281
Comment (tr|C9Z138|C9Z138_STRSW) Uncharacterized protein {ECO:0000313|EMBL:CBG72648.1} KW=Complete proteome; Reference proteome OX=680198 OS=Streptomyces scabiei (strain 87.22). GN=SCAB_56211 OC=Streptomyces.
Sequence
MTQPTPLRRALALAAHGVPALPLRAGKAPFGNCPTCAGNACGGRPNMKTPGPCTCPRPCH
GWAAATTDAYVLTSPPWAPAWRRAAAVAYHPGGAGVTVVDLDNAAAVDWARATLPTTRTV
PTTRGEHWTYRGVMRSVNGVREGVDIKSTMSYTRWLGPGVGATAALPDAVRALAVREPFP
SRRAPQALTVPPRGGQGECPHRTPTYLDRGVAMAEQRITEARSAVHATVYRTFLAVLSTH
GRCGCLTDTHVNRLFTAAQAKGESVRHCTDAWSNALTTLGL
Download sequence
Identical sequences C9Z138
WP_013003218.1.11737 WP_013003218.1.94791 gi|290960007|ref|YP_003491189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]