SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9ZE96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9ZE96
Domain Number 1 Region: 48-187
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.01e-48
Family Ricin B-like 0.00061
Further Details:      
 
Domain Number 2 Region: 204-430
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.25e-18
Family Carboxylesterase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9ZE96
Sequence length 457
Comment (tr|C9ZE96|C9ZE96_STRSW) Putative secreted glycosyl hydrolase {ECO:0000313|EMBL:CBG74887.1} KW=Complete proteome; Reference proteome OX=680198 OS=Streptomyces scabiei (strain 87.22). GN=SCAB_79261 OC=Streptomyces.
Sequence
MKTHGAAHPAAPARHRWWSRVAALVAATLAIGMLAAAHPAPAAAATVDTNAWYVLVNRNS
GKALDVTGASTADGTRVSQRTRNDGTNQQWRFTDSGDGFYRLKARHSDKVLDVAGASTAD
GAAIQQWADHNGANQQFRLADSDAGHVRLINRGSGKAVEVQGASTADGGNVVQYTDWGGA
NQQWQMIKMSSGGGAGGCGNAPTLASGTHTIQSGGKSRSFILRVPANYDNSRPYRLIFAF
HWRGGTAGDVASGGTSGSAWSYYGQQEQSGNSAILVAPQGLGNGWGNAGGEDVTFVDDMI
RRIEGGLCVNPAQRFATGFSWGGGMSYALACSRANVFRAVAVISGAQISGCDGGSQPIAY
LGIHGVGDSVLNIGQGRSLRDKFVGNNGCTPQSPREPAPGSRTHITTAYAGCRAGYPVQW
AAFDGGHIPGPVDGSSGESGVTTWTKAEIWRFFAQFS
Download sequence
Identical sequences C9ZE96
gi|290962235|ref|YP_003493417.1| WP_013005337.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]