SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9ZEA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9ZEA8
Domain Number 1 Region: 46-268
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.76e-45
Family ThuA-like 0.057
Further Details:      
 
Domain Number 2 Region: 459-579
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.41e-39
Family Ricin B-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C9ZEA8
Sequence length 580
Comment (tr|C9ZEA8|C9ZEA8_STRSW) Putative secreted glycosyl hydrolase {ECO:0000313|EMBL:CBG74899.1} KW=Complete proteome; Reference proteome OX=680198 OS=Streptomyces scabiei (strain 87.22). GN=SCAB_79391 OC=Streptomyces.
Sequence
MPVTKKGVTHMRRRPRTLLGGAATALATLVLLGQPHPVHAADTAYDVLVFSRTAGFRHDS
IPAGIQAIRELGTANNFTVTATEDGSQFTTGDLSRYEAVVFLNTTGDVLNDTQQSAFQSY
IGSGGGFVGVHSAADTEYNWPFYGDLVGAWFASHPAVQRADVKVEGRAHAATAHLPQTWT
RTDEWYNFRTNPRTTARVLTTLDESSYSGGSMGADHPHSWCKTHSGGRAFYTGGGHSQAA
YAEPAFRAHLLGGIRYAAGRTKADCRPETGYTALYNGSTTGWSQAGPGGFTHTDATLTSY
GGLGMLWYSAKQFTNYSLKLDWKMPGDDNSGVVVGFPPTNDPQSALDNGYEVQIDATDAP
DRTTGSIYAVKAPDTAVRDAALNPPGEWNTFEVLVEGERLQVWLNGVKINDFTNTDPARS
LAGHVGIQNHGTGDDVSFRNVRIKDLGGGPTPTPGAGPIVGVAGKCLDVRDGSSADGTAV
QISSCTGAARQQWTVASGATVKALGKCLDVSGGSTADGARVVLWSCNGGANQNWQASADG
SLRNPRSGKCLDVSGGGSSDGTLVNLWSCHGGANQKWTLP
Download sequence
Identical sequences C9ZEA8
gi|290962247|ref|YP_003493429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]