SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9ZEC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9ZEC6
Domain Number 1 Region: 288-752
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.02e-89
Family Glycosyltransferase family 36 C-terminal domain 0.057
Further Details:      
 
Domain Number 2 Region: 810-943
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.21e-33
Family Ricin B-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9ZEC6
Sequence length 945
Comment (tr|C9ZEC6|C9ZEC6_STRSW) Putative secreted protein {ECO:0000313|EMBL:CBG74917.1} KW=Complete proteome; Reference proteome OX=680198 OS=Streptomyces scabiei (strain 87.22). GN=SCAB_79571 OC=Streptomyces.
Sequence
MTRRRFLAAGAAAGAAVVPGGWTAVARAGSAAPPEVRAADDLALWYDKPAGADWLRALPI
GNGRLGAMVFGNVDTERLQLNEDTVWAGGPYDSANTRGAANIAEIRRRVFADQWGPAQDL
INQTMLGSPAGQLAYQPVGNLLLSFGSATGASQYKRTLDLTTATALTTYALNGVRYQREV
FVGARDQVIVVRLTADRANAITCSATFDSPQRTTLSSPDGATIALDGTSGTMEGITGRVR
FLALAHAAATGGTVSSSGGTLRVSGATSVTVLVSIGSSYVDFRNTDGDHRGIARRHLDAA
RDIDIDALRSRHRTDHQALFDRVSIDLGRTTAADQPTDVRIAQHAQVSDPQFAALLFQFG
RYLLISSSRPGTQPANLQGIWNDQMAPSWDSKFTINANLPMNYWPADTTNLSECLLPVFD
MIDDLTVTGARVARAQYGAGGWVTHHNTDAWRGASVVDGAQWGMWQTGGAWLATLIWDHY
LFTGDTDFLRSNYPALKGAAQFFLDTLVAHPTLGHLVTNPSNSPELPHHTNATVCAGPTM
DNQILRDLFTSVARAGETLGVDAGFRAQALAARDRLAPTRVGSRGNVQEWLADWVETERN
HRHVSHLYGLHPSNQITKRGTPQLHEAARRTLELRGDDGTGWSLAWKINFWARLEDGARA
HKLLRDLVRTDRLAPNMFDLHPPFQIDGNFGATSGIAEMLLHSHNGELHVLPALPAAWPT
GRVSGLRGRGGYTVGAEWSGGRIECVVTPDRTGAVRVRSRIFAGDFTLRDEASGDPVQPK
RLETDLIEFAGRAGRTYRASAVRSGPVEAGVAYRLVAQHSGKAADVNGASAGAALIQWQT
AAGRNQQFEFLPSDGDHYKIRVRPSGLVLHVADSSSGADITQQADTDAADRQWRIVDHGG
GVISLVNRQSGLALDVWQASTADGARISQWTATGSPNQRFQLHRV
Download sequence
Identical sequences C9ZEC6
gi|290962265|ref|YP_003493447.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]