SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0KCA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0KCA4
Domain Number 1 Region: 16-148
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.49e-18
Family SMI1/KNR4-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D0KCA4
Sequence length 163
Comment (tr|D0KCA4|D0KCA4_PECPW) Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein {ECO:0000313|EMBL:ACX89992.1} KW=Complete proteome OX=561231 OS=(strain WPP163)). GN=Pecwa_4272 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MINTAGIYMNTEKFVKIVDYVRNEKPNWFLTEDNFLAKKEDVMVIEREVNGSLPDEFVFF
SLKYKSGYFAFLNIYSLSPSSEWYILIKNREYQSVPECFLSFSDDETGGYYGFLKDNGHY
SNNVYFYDSSSNESPISMEKNFFDFVIDKAFQPDHFKLTLTEV
Download sequence
Identical sequences A0A0H3IEH9 D0KCA4
WP_014701867.1.14155 WP_014701867.1.78307 561231.Pecwa_4272 gi|261823493|ref|YP_003261599.1| gi|470156857|ref|YP_006285359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]