SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0KCY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0KCY9
Domain Number 1 Region: 9-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000103
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D0KCY9
Sequence length 169
Comment (tr|D0KCY9|D0KCY9_PECPW) Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein {ECO:0000313|EMBL:ACX90005.1} KW=Complete proteome OX=561231 OS=(strain WPP163)). GN=Pecwa_4305 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MAIKLSIGIDYLDVKDVESKYGITFPSDYIDFLTKYNGIYIGAGSYCTIPFSKVDDGEID
FQEMYGINTINPSFDLLRANDIRNEVVVLDNPFIIGSDPGGNPFFINCEKSDSAVYYWDR
THIHFDNNFDYQETNEEGNIYKLSDSFYKFYDFIMVNVGGDKKTIKEHL
Download sequence
Identical sequences D0KCY9
561231.Pecwa_4305 WP_015731455.1.14155 WP_015731455.1.70306 gi|261823506|ref|YP_003261612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]