SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0KDI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0KDI2
Domain Number 1 Region: 8-101
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000275
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D0KDI2
Sequence length 120
Comment (tr|D0KDI2|D0KDI2_PECPW) Uncharacterized protein {ECO:0000313|EMBL:ACX86018.1} KW=Complete proteome OX=561231 OS=(strain WPP163)). GN=Pecwa_0162 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MKKNEVMEKLADIEKILDKKLPEKYKCFLSEEVVENECYEIKNSQGGLIYIFNYHDVLER
NETYTIRDVEPDYFLIGQDGDIGYFIYLSDNDDKVYSLDLGALGSLDMDEESQDIYNLRT
Download sequence
Identical sequences A0A0H3HWU9 D0KDI2
gi|261819519|ref|YP_003257625.1| WP_012821995.1.14155 WP_012821995.1.36680 WP_012821995.1.70306 WP_012821995.1.77019 WP_012821995.1.78307 gi|470152676|ref|YP_006281178.1| 561231.Pecwa_0162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]