SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0KEI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0KEI8
Domain Number 1 Region: 28-166
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000131
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0KEI8
Sequence length 174
Comment (tr|D0KEI8|D0KEI8_PECPW) Uncharacterized protein {ECO:0000313|EMBL:ACX86112.1} KW=Complete proteome OX=561231 OS=(strain WPP163)). GN=Pecwa_0258 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MTIEKTDLNNWDMDEPNFIPDVNKINSSITFIQNELKVIIPNEMQELMFLTNDKPIGPTE
GIDSVLVKYNDKTIIINIEITYSSNYIVEYTKLSQESIYEKRFLLPNGLIVIGSNYDDAG
YACLIYDVRPDSVTYKHVFHWRHYVDNLIMGEGLGLIAHSLKEFLSMPTSEDAL
Download sequence
Identical sequences D0KEI8
561231.Pecwa_0258 WP_012822071.1.14155 gi|261819613|ref|YP_003257719.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]