SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0LFY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0LFY3
Domain Number 1 Region: 8-192
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.41e-49
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0LFY3
Sequence length 339
Comment (tr|D0LFY3|D0LFY3_HALO1) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=502025 OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2). GN=Hoch_2040 OC=Nannocystineae; Kofleriaceae; Haliangium.
Sequence
MSQTSTQHERVLCMGASAGGLTALRRLVAELPADFPAPICLVQHTPSDGPRLLDGLLTQA
GKLRARFAEDGEPLTAGTIHIAPPGMHMVIDDGRLRHVRGPRENLARPAIDPLFRSAALH
FKQQTIGVLLSGMLDDGVAGLSVIERCGGVAVIQDPEDAEAADMPQNALDAIGERLAAVL
PADALGRYLRELRTVEPRTGANCPEHLGAEHRMFVAASGIDVVPMIGDPAALSCPTCGGP
LWEMPDEDVRRYRCHVAHGFTTQCLGEEQRTGMEEALWAAVRTLDERVKTLGVMIQDAEK
RGYRRIVDMYSDERKEAKRHADALRELFLGNLDKSPKGN
Download sequence
Identical sequences D0LFY3
gi|262195269|ref|YP_003266478.1| 502025.Hoch_2040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]