SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0LPT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0LPT1
Domain Number 1 Region: 263-299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000969
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 159-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 195-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000825
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 122-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000254
Family LDL receptor-like module 0.0033
Further Details:      
 
Weak hits

Sequence:  D0LPT1
Domain Number - Region: 229-260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000113
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0LPT1
Sequence length 301
Comment (tr|D0LPT1|D0LPT1_HALO1) Low density lipoprotein-receptor, class A, cysteine-rich {ECO:0000313|EMBL:ACY15444.1} KW=Complete proteome; Reference proteome OX=502025 OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2). GN=Hoch_2927 OC=Nannocystineae; Kofleriaceae; Haliangium.
Sequence
MTGMLRSRIAEQWGRSASRVWLVRCGGAWLACALLAVSACGGGGDGDGGGDGGGQEGPLY
DELRACDVLTSGYFAGRVQVRDEIRACYEQCLLELSCDELREGFCDPLSEPGEACERECD
PRFACADGGEAYERERCDGLWQCQDGSDEDGCESVMPPPEVFLCESGMGESSPQSAVCDG
RAECADGSDEQDCEYFYCDDGAPVHVDAVCDRVSDCFDNSDESGCPEPEPYLCEDGFPLT
ADDVCDGNPECQYGEDELDCPGEDSFRCGDGRDIPLKMRCDLQDDCDDGSDEDGCARLSC
L
Download sequence
Identical sequences D0LPT1
502025.Hoch_2927 gi|262196128|ref|YP_003267337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]