SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0MTR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0MTR4
Domain Number 1 Region: 43-180
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.7e-19
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D0MTR4
Sequence length 194
Comment (tr|D0MTR4|D0MTR4_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY61361.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_01651 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MLPFGCHGEKWLFLVRKRQSFVVPTDITGDDYQWLVHNLSKQRRLQGTRLEQKRTLDRDV
DRTFHQLQIRMVNSRLSSFLSKHQYSSSDIKTWRSSTHQLLSVFLMLKPQIGYCQGMTSV
AAVLVQESKMNSEIAFRLFLALSEKYRLDDVYRPDMKDVNLRYFQLDEALRLHLPRLHAH
MSDRDIHPSTYASW
Download sequence
Identical sequences D0MTR4
PITG_01651 XP_002908278.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]