SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0N1P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0N1P0
Domain Number 1 Region: 366-505
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.15e-20
Family Ypt/Rab-GAP domain of gyp1p 0.022
Further Details:      
 
Domain Number 2 Region: 480-584
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000136
Family Ypt/Rab-GAP domain of gyp1p 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D0N1P0
Sequence length 635
Comment (tr|D0N1P0|D0N1P0_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY68219.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_04634 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAGKKSNAMAAKYPRANALVGSVLNKYHNGSERAVDSFVIRTLKEHEPRLLGIQCFLDQG
PAENSRRIKDESHVAQHTPCASGVFGVLSVCGGLFGPGAIMRQWDACSGTEGEPDDRESA
MTEYVATVDKILPGWDEAVPNHPVASPDRFWEDDAAAAQCPLCSVVFSEEEQKLRSLAVD
AGCDVQALDEAIQKQHGGSLIGSAPMEIPIPPAAHRFASAHTSVEASNQLALAHRQLTMS
FKMAQCRAHKVLDKMDATIAALQGALIAQRAPSNKSPPSGHSEDNGWRDNRTRTFVADLA
EAVQALLDASSGSDTEDSDANEAPVSMSRPSWEKPAQTDPPTSVPSVPSSMELEKAYELI
RSQCETGPASEWDEQIRLDVTRTFGISARRQHRKSVDPKSRTVCNSAGIAIPVEKRRSAL
ENVLRACASVDTDVGYCQGMDHVAALVLAVSDWNEARAFWFLVSLLASPRFELERLYGPG
LPHLSLRCFQLDRLLGIHLRPLCEHFHTIDFPISIVATGWFMTLFTNMEALSYDVVVQVF
EGFIFKGWKQLFQTALAILQDLQGPILASSFDEIPRLFYDIQEYAVQKALRFLIDIARND
TGTVVKTLGTTRRRFPACAFIVDWGVQPVLAHPQQ
Download sequence
Identical sequences D0N1P0
XP_002905378.1.21288 PITG_04634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]