SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0N965 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0N965
Domain Number 1 Region: 346-474
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.5e-25
Family Chaperone J-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 9-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000765
Family Ubiquitin-related 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0N965
Sequence length 478
Comment (tr|D0N965|D0N965_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY54353.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_07971 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MEGGIWAFYYLQGEDGEDRSHPNAFKLTGVSSGADVTLADVLRSFPLRNPAAFHFRFRLN
SSKSNTFYWLDVTQPTQKVPLAGGRVICKLLRLERPKKPGLVFRRRPVLKWASGSQPPKR
QGSSSALGDSSNSVQSVKSVQPLGEGNNFHRSSSSQGFEQGRPAKYSDRTPGSGSGADSR
HSNASSRTSSISGDKKPVSRTGSGSKPAAPEAQGNLEDFLSGSQKVPSAGAAPSSSPPKK
DVNLMSDSGWNDAPATPAQPANATSDFLNAMDPLATRSAPSQPSPSKTVLRDPPKFDDDN
GQTVGPVTMAEMEAHSKSTSDGSNVYNPNLVDKSTKSDDVRRAMEERERQVQRDVERARD
DLRKREEAVRNMAAMKDSASTVLGPRLKAWAEDNGRVKNIRTLLSTMHQVMWEGCKWTEV
NMGKLIQPNDIKKHYRKAMIVVHPDKAGGRNAEQLLIAERVFAALNTAWEDFQKTNPC
Download sequence
Identical sequences D0N965
PITG_07971 XP_002904175.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]