SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0NDQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0NDQ2
Domain Number 1 Region: 119-236
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000226
Family Universal stress protein-like 0.028
Further Details:      
 
Weak hits

Sequence:  D0NDQ2
Domain Number - Region: 250-348
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00117
Family Universal stress protein-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0NDQ2
Sequence length 385
Comment (tr|D0NDQ2|D0NDQ2_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY56209.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_09009 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MLDVLIKKSSPALWLCIQILRLVLSIKEPELTDESFRAHLLDFPDEVLAQCKTLEPEDIS
QLTHEQLCSLMDDADYDPALAARESESGLFLDIHTTLMELRSRMEQEHSDNKRLSPTAKF
MVGVDGSRQSYRAFELAARLRRQGQLVVINVGEELAASRQLPQISGEFITEEYKAHCARL
QLPTNRQLLLIAERERVDFLVLGAHGKGGPAIDQVHHVPREVLRRVTSIPTIVVPPAPVS
SVFSKQYVFVVAVDKSTTAARCLNATLKLMRPVDILRIVHFYENPITGEYDVEPFEWYKG
VIAGAQIDGIVDIQLIERTSTIAESLQDYLSTHTAAYLVLGVNGEGTEKKAEDPEAEEIG
EHGKHIGRLASAMLFSPRCTLCLCP
Download sequence
Identical sequences D0NDQ2
XP_002903039.1.21288 PITG_09009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]