SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0NNB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0NNB2
Domain Number 1 Region: 53-139
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.24e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0NNB2
Sequence length 408
Comment (tr|D0NNB2|D0NNB2_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY62019.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_14007 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MNYVVAALLLVMKDAQEVTDTDLDGLSTQEAAFWLTLALIRRKGMAELWKHKMPGLSQCI
YLFQQLLKLHFYDLSAHFRHIGMHSSILVTQWFVTIFARVLALPTLVRVWDLVLLDGWKA
VYRVALAITAELRPKLLAMFFRKNPKLGLEEYLRLRLQQTPLSEEHRMLFPTLEHEDVAA
KKKSLELIRSKLQRFDTDVASDTVFLQHKIELAEKAQATAMSVRYAIAYELSEAAIELNE
RLEIKNRLRSKFRKLMATAITEATTSSSSSSSGFSLWMNPFDFLNERMASCFERLPLISS
YLDTDTDDEEDIEAQQNLKHLDMLVPQLAAELRLLQRSLAYNERLVRPLVQRTRRLQRDA
QLARVEVEETQLFKDRLADQLLQIMLTSEKLKNERMQQLFAEVDRNKL
Download sequence
Identical sequences D0NNB2
PITG_14007 XP_002899659.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]