SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0S8H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0S8H5
Domain Number 1 Region: 19-43,107-170
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000279
Family Haloperoxidase 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D0S8H5
Sequence length 177
Comment (tr|D0S8H5|D0S8H5_ACIJO) Uncharacterized protein {ECO:0000313|EMBL:EEY97697.1} KW=Complete proteome OX=575586 OS=Acinetobacter johnsonii SH046. GN=HMPREF0016_00780 OC=Moraxellaceae; Acinetobacter.
Sequence
NDHTSTRRCTFSWPLLWGAVITEVGNQPNVVGLVYIAAFAPDAGESPGGITQQHLPVGAP
NLEPDSDGYLWVKADKYHESFCQDLTNDEGLVMGITQKAPVASTFGDTISNPAWKNKPSW
YQISTEDRMIHPENQAMMSSRLNAQKVISLDASHASLASQPKAVADLIDEAATFLAR
Download sequence
Identical sequences D0S8H5
HMPREF0016_00780T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]