SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1A6R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1A6R8
Domain Number 1 Region: 1-379
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 5.71e-62
Family Gtf glycosyltransferase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D1A6R8
Sequence length 380
Comment (tr|D1A6R8|D1A6R8_THECD) Uncharacterized protein {ECO:0000313|EMBL:ACY98322.1} KW=Complete proteome; Reference proteome OX=471852 OS=NBRC 15933 / NCIMB 10081 / Henssen B9). GN=Tcur_2776 OC=Thermomonospora.
Sequence
MRFLFMTGGGSAPIHASVPLAWAARTAGHEVIMAAPQENLDLIVGLGLPAAPVTRLGMGD
AMLKDREGNWLPMPTGEDDEMDFAGRGFARLAAASYEGAAKLVEAWRPDVVIGGEYTLVA
PLIAHRFGLPLVSHTWAIYDRTDVDWQGATDELRPELSRFGLEQVPAWDLFVDITPPSVR
PAHAEPAQPMRWTPGNSQVPLEPWMYTKGDRPRVVLTSGSRSMFVPNLGVDFFRPLLQTP
LLSSGEVEVIAATSEAVAAHLREEFPGLKAGYVPLDVVAPTADAVVHHGGGVTVMTLLNA
GTPQVVLPEIKYSAIPLRPVDEFGASITLPSHREPPEEVAAAISKILENPSYAGRAAKLA
EEIAGMPAPAEVVKKIEALV
Download sequence
Identical sequences D1A6R8
gi|269126990|ref|YP_003300360.1| 471852.Tcur_2776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]