SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1BQS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1BQS9
Domain Number 1 Region: 53-114
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.000000000000017
Family TonB 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D1BQS9
Sequence length 115
Comment (tr|D1BQS9|D1BQS9_VEIPT) TonB family protein {ECO:0000313|EMBL:ACZ23892.1} KW=Complete proteome; Reference proteome OX=479436 OS=(Veillonella alcalescens). GN=Vpar_0205 OC=Veillonella.
Sequence
MNKVLRCIILSSLFVMSMVASVLAAPYDPPVAIATPPIDRALLSAYGEAAHGADIRFTIK
EDGSVGDVEVVSSSGSSALDAAIVDTISKWRFSPATDSNGRPVASSKTEYIDFKN
Download sequence
Identical sequences D1BQS9
479436.Vpar_0205 gi|269797272|ref|YP_003311172.1| WP_012863800.1.68909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]