SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1BUD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1BUD5
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.96e-46
Family Glutathione peroxidase-like 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1BUD5
Sequence length 152
Comment (tr|D1BUD5|D1BUD5_XYLCX) Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen {ECO:0000313|EMBL:ACZ31148.1} KW=Complete proteome; Reference proteome OX=446471 OS=/ XIL07). GN=Xcel_2130 OC=Xylanimonas.
Sequence
MALQPGEPAPDFTLQDTHGTPVHLADLLADGPVLLVFFPFAFSGICTGELCELRDNIEDF
ETAGVRLVAVSTDPVFTLKAWQQVEGYTFDLLSDFWPHGAVARAYGVLDEQNGHALRGTF
LIDAGGVVRWSVTNPRGQRRDLQAYRTALAEI
Download sequence
Identical sequences D1BUD5
gi|269956917|ref|YP_003326706.1| 446471.Xcel_2130 WP_012878890.1.53538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]