SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1BVX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1BVX5
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-16
Family Thioltransferase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D1BVX5
Sequence length 80
Comment (tr|D1BVX5|D1BVX5_XYLCX) Glutaredoxin 2 {ECO:0000313|EMBL:ACZ29478.1} KW=Complete proteome; Reference proteome OX=446471 OS=/ XIL07). GN=Xcel_0439 OC=Xylanimonas.
Sequence
MVLFTRAGCHLCDDAREVVARVCGTLGETWHEVDVDTGPESATLRDRYGDYVPVVEVDGV
QQGFWQVDGDRLARRLTGRR
Download sequence
Identical sequences D1BVX5
446471.Xcel_0439 gi|269955247|ref|YP_003325036.1| WP_012877222.1.53538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]