SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1BZE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1BZE2
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.55e-30
Family Thioltransferase 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D1BZE2
Sequence length 123
Comment (tr|D1BZE2|D1BZE2_XYLCX) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome; Reference proteome OX=446471 OS=/ XIL07). GN=Xcel_1065 OC=Xylanimonas.
Sequence
MATVELTDDTFRETVEGNDIVLVDFWATWCPPCRQFGPVFEKSSETNPDVVHGKIDTDAQ
QRIAAAAGITSIPTLMAFREGVLVFSQPGALPAPALQQVVDAVKALDMNEVREAIEAEAA
GSN
Download sequence
Identical sequences D1BZE2
gi|269955865|ref|YP_003325654.1| WP_012877838.1.53538 446471.Xcel_1065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]