SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1CCB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1CCB9
Domain Number 1 Region: 2-291
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.33e-90
Family TK-like PP module 0.000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1CCB9
Sequence length 297
Comment (tr|D1CCB9|D1CCB9_THET1) Transketolase domain protein {ECO:0000313|EMBL:ACZ42434.1} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_1528 OC=Bacteria; Thermobaculum.
Sequence
MSTISIDIPPSPTRDPDKLREIARKIRALVLKSVYHAGAGHIGGPLSAADILATLYFAVL
NVDPSNPEWEDRDRFILSKGHSAIGYYAALALRGYFPVEELQTFDAINSRLQGHPDMTVT
PGVDMSTGSLGQGLSVGLGMALGAKVLGKSFHVWVLVGDGEMQEGQIWEAIQTAPRFHLD
NLVAIVDYNGLSQYGWTSSPSGYSGTRREPPILNPGDKVRAFGWNVIEIDGHDPQQILHA
CDLAKLHKDEPTFIVAHTVKGKGVSFMEGQYPWHSKPLTLEDLNKALRELGEAEVAE
Download sequence
Identical sequences D1CCB9
WP_012875468.1.85100 gi|269926633|ref|YP_003323256.1| 525904.Tter_1528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]