SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1CCP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1CCP4
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily L28p-like 1.77e-16
Family Ribosomal protein L28 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1CCP4
Sequence length 73
Comment (tr|D1CCP4|D1CCP4_THET1) 50S ribosomal protein L28 {ECO:0000256|HAMAP-Rule:MF_00373} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_1653 OC=Bacteria; Thermobaculum.
Sequence
MARCEVCGKKTQFGRSIQYHHGGKWARRAQKTNRPFKPNVHRQTVMLNGELVKIHICTRC
LRTLAKKAESTAA
Download sequence
Identical sequences D1CCP4
525904.Tter_1653 gi|269926758|ref|YP_003323381.1| WP_012875593.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]