SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1CD93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1CD93
Domain Number 1 Region: 4-193,241-378
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.46e-78
Family TK-like PP module 0.0076
Further Details:      
 
Domain Number 2 Region: 313-502
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.28e-63
Family TK-like Pyr module 0.056
Further Details:      
 
Domain Number 3 Region: 488-623
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.49e-36
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1CD93
Sequence length 640
Comment (tr|D1CD93|D1CD93_THET1) 1-deoxyxylulose-5-phosphate synthase {ECO:0000256|HAMAP-Rule:MF_00315} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_1852 OC=Bacteria; Thermobaculum.
Sequence
MSRILDTIESPDQLKNLTHDQLKQLAQEMRERLVETVYGVTGGHFSSNLGTVEIAIALHT
VFDSPRDKIIWDVGHQAYPHKMLTGRNKLMHTIRQYGGLAPFLMREESPHDQFGAGHAST
SISAALGMAVARDMQGEDYHVVAVIGDGALTGGMALEALNNLGHLGTKMIVLLNDNEMSI
YPNVGVVPRLLTRLRTSRTYHRAKGDVVSILQRMPAGDALVELGKRFKDSVKELVIPNMM
WEELGLTYLGPIDGHNLADLQETLTLAKQLDRPVLIHAITIKGKGFEPAEAESKTHKWHS
VTPKSPGKSDNKPSAPRYQDVFAQTLIRLAEEDERIVGITAAMPDGTSLDQFGKRFPDRM
FDVGIAEQHAVTFAAGLAAAGMRPVAAIYSTFLQRAYDQVVHDVAMQNLPVVFAMDRAGI
AGNDGRTHHGALDISYLRCVPNMTLMAPKDENELQHMLKTALSLEGPAAIRYPRGNGYGV
PLSETFHVIPVGTWELLQEGEDLLILATGYSVYQALEAAKILSKQDGIFATVVNCRFIKP
LDEELLQKLVAKHDYLITVEENVRMGGFGSAVLESLADHSMVPSRFVRLGMPDRYVEHGS
QEILRKILGLDAEGIAQTARELLYKTTDLRDKTLKDVHQR
Download sequence
Identical sequences D1CD93
WP_012875789.1.85100 gi|269926957|ref|YP_003323580.1| 525904.Tter_1852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]