SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1CDK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1CDK7
Domain Number 1 Region: 2-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.93e-72
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000249
Further Details:      
 
Domain Number 2 Region: 189-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.7e-45
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D1CDK7
Sequence length 324
Comment (tr|D1CDK7|D1CDK7_THET1) Transketolase central region {ECO:0000313|EMBL:ACZ41013.1} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_0091 OC=Bacteria; Thermobaculum.
Sequence
MAVKTYREALNEALREEMERDPNVFIIGEDVGKFEGAYRVTQGLLAQFGPKRVRDAPISE
TGFLGAGIGAAMLGLRPVVEFMTINFILVAMDQVINHAAKIRYMFGGEVSVPMVIRAPGG
AGQQLTAQHSQSFEVWFAHTPGLKVMAPSSPSDAKGMLKTAIRDPDPVFFLENLALYNTK
GEVPEGEYTVPLGKADVKRQGTDVTLISHSRAVNWCLQAAQQLEKEGVSVEVVDLRSLRP
LDMETVIESVKKTNRAVTVEEGWLSFGVGAEVASRLMEQAFDYLDAPVLRVGGAEVPMPY
AKPLERAAMPSVDKIVARVREVLE
Download sequence
Identical sequences D1CDK7
525904.Tter_0091 WP_012874048.1.85100 gi|269925212|ref|YP_003321835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]