SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1CDK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1CDK9
Domain Number 1 Region: 20-341
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.05e-105
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1CDK9
Sequence length 344
Comment (tr|D1CDK9|D1CDK9_THET1) Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain {ECO:0000256|RuleBase:RU365014} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_0093 OC=Bacteria; Thermobaculum.
Sequence
MATTQDEISATNSQDRHTELGLTAEDLKKMYRLMVLARTLDERMWILNRQGKVHFVISGQ
GQEGAQIGTAYALRPGVDFFVPYYRDLTVCLYAGVTPREIMLSLFARADDPASGGRQMPG
HYSYKPLKIVTGSSPIATQIPHAVGIALASKIKNEDVVTAVWFGEAASSKGDFHEGLNFA
GVIKAPVIFICENNHYAISVPQNKQMAVPNVADKACAYGFPGVVTDGNDVLDVYKAMKAA
VERARAGEGPTLIECKTYRIVPHSSDDDESRYRTKVEVEEWKRKGPIERLRTYMQAQGIW
SEEFENQVKSEALSIVDDATRFAEQASPPSPSSLLRHVFAEEAK
Download sequence
Identical sequences D1CDK9
gi|269925214|ref|YP_003321837.1| WP_012874050.1.85100 525904.Tter_0093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]