SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1CEF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1CEF1
Domain Number 1 Region: 15-149
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000103
Family PP2C-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D1CEF1
Sequence length 269
Comment (tr|D1CEF1|D1CEF1_THET1) Serine/threonine phosphoprotein phosphatase {ECO:0000313|EMBL:ACZ41307.1} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_0385 OC=Bacteria; Thermobaculum.
Sequence
MTCSWKYAFASVIGTYHLSRGLPCQDAIRVSLCRLEKEDVLLAVVSDGAGSAARGDEGSE
FACQFFVEKLHDFVLSGSEICTLDRELCVGWVKDYLSHLEERANSCEAQISDYASTLLAA
VVGSRSAVFLQIGDGAIVASTEDDPDSYTAIFWPQKGEYESTTFFLTDNNSHENLLILSL
DDVSICDLAIFTDGLQRIALDFTENEAYNPFFRGMFNPLRGQFDGYLQELSEQLKNFLGS
PRVNEYTEDDKTLLLASRVIGQQLSEVPD
Download sequence
Identical sequences D1CEF1
WP_012874342.1.85100 525904.Tter_0385 gi|269925506|ref|YP_003322129.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]