SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1CEQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1CEQ5
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily L28p-like 1.69e-24
Family Ribosomal protein L31p 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1CEQ5
Sequence length 94
Comment (tr|D1CEQ5|D1CEQ5_THET1) 50S ribosomal protein L31 {ECO:0000256|HAMAP-Rule:MF_00501, ECO:0000256|SAAS:SAAS00804274} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_0490 OC=Bacteria; Thermobaculum.
Sequence
MKPNIHPQYVEATVHCSCGNTWKTRSTKPNIRVDLCSKCHPFFTGEQRIVDTAGQVDRFM
RRLERRQAGRGGGTPVTIPAEERPTVAEAESQEQ
Download sequence
Identical sequences D1CEQ5
525904.Tter_0490 WP_012874446.1.85100 gi|269925610|ref|YP_003322233.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]