SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1CF47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D1CF47
Domain Number - Region: 212-365
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0144
Family Pyruvate oxidase and decarboxylase, middle domain 0.032
Further Details:      
 
Domain Number - Region: 365-436
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0147
Family Pyruvate oxidase and decarboxylase, middle domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D1CF47
Sequence length 450
Comment (tr|D1CF47|D1CF47_THET1) LOR/SDH bifunctional protein conserved domain protein {ECO:0000313|EMBL:ACZ41553.1} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_0636 OC=Bacteria; Thermobaculum.
Sequence
MQGQNNGRSSLPFYKTIELRGHIIDSHILSQVMDLVMDYNAEFYIEQFEVGKHKYDPSYA
RLILYAPTPETLDELMEAVTKLGAQLLESEEVDARTEPAPKDGVLPEDFYSTTNMPTEVR
IDGKWFPVENIEMDVAIAIRLNEEGKPIGAYTVPMSDVRKGTPIVVGHQGIKVSPIERPR
SPALLGSPSRASQGHVFSFMSSAVSTERPKAAAIAEIAQRMREIRDSGGTTLVVGGPAIV
HTGAGPQLAALIRHGFVHLLFAGNALAAHDIESAFFNTSLGVSLDANSEGATYEHGHEHH
IRAINKIRYYGGIRQAVEAGVLKQGIMYECIVNNVPYVLAGSIRDDGPIPDVITDVIEAQ
RAMRRHIQAGVDLALLIGTTLHSIAVGNLLPANVLTVCVDINPSVVTKLLDRGSLQTAGL
VIDAGGFLRELCYQLGLREKSSIDSPTKVQ
Download sequence
Identical sequences D1CF47
WP_012874588.1.85100 525904.Tter_0636 gi|269925752|ref|YP_003322375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]