SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1Z0B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1Z0B0
Domain Number 1 Region: 17-234
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00000000000000989
Family Terpene synthases 0.032
Further Details:      
 
Domain Number 2 Region: 181-332
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0000706
Family Terpene synthases 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D1Z0B0
Sequence length 334
Comment (tr|D1Z0B0|D1Z0B0_METPS) Uncharacterized protein {ECO:0000313|EMBL:BAI62132.1} KW=Complete proteome; Reference proteome OX=304371 OS=SANAE). GN=MCP_2060 OC=Methanocellaceae; Methanocella.
Sequence
MGDWTAALNGYPIDWLLEEDNPSVRYFTLTGLLQKPVNDPEVVSAKRSLMMNGLIPSILA
KQEAAGYWGMPEDFYVRSKYKGTVWTLILLAHLGADGSDPRIKKACEYILDYSQDRESGG
FSYRRFRGAAYRDGLLPCLTGNMAWCLIRFGYLDDPRVQRSIEWITQYQRFDDGDGSPSG
WPYGKHEACWGRHTCHYGVVKALKALAEIPPRKRSKPVKATIEAGAEYLLKHRIYKSSHD
PEKVTMPGWLKFSFPRMWSTDALEVLGILARLGYRDERMQDAIDAVLEKQDAQGRWLNED
RYGSRYIMRVDRTGRPSRWVTYEALHTLKLLKFP
Download sequence
Identical sequences D1Z0B0
gi|282164730|ref|YP_003357115.1| 304371.MCP_2060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]