SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2B2Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2B2Y8
Domain Number 1 Region: 40-447
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 6.28e-80
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000467
Further Details:      
 
Domain Number 2 Region: 454-773
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 4.32e-42
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000216
Further Details:      
 
Domain Number 3 Region: 876-974
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.6e-27
Family Cellulose-binding domain family II 0.00016
Further Details:      
 
Domain Number 4 Region: 780-875
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000213
Family Fibronectin type III 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2B2Y8
Sequence length 978
Comment (tr|D2B2Y8|D2B2Y8_STRRD) Endo-1,4-beta-glucanase/xyloglucanase, putative, gly74A {ECO:0000313|EMBL:ACZ85468.1} KW=Complete proteome; Reference proteome OX=479432 OS=NI 9100). GN=Sros_2492 OC=Streptosporangium.
Sequence
MRRRLFSVLAAVAVACAAVGTAVGGGAASVSPSSAAAEPYEWKNVRIDGGGFVPGIVFNQ
TEKDLIYARTDIGGAYRWEQASRSWTPLLDWVGWDKWGYNGVVSLATDPVETGRVYVAAG
MYTNDWDPNNGAVLRSADKGRTWQATPLPFKLGGNMPGRGMGERLAVDPNDNGVVYLGAP
EGNGLWRSTDKGVTWAKVTSFPNPGNYAQDPSDPNGYLSHRPGVVWVTFDPSSATAGQRT
QRIYVGVADKENTVYSSADAGVTWTRVAGQPTGYIAHKGVLDHAGHALYIATSDTGGPYD
GGKGDVWKLDTVTGAWTRISPIPSSSADDYFGYSGLTIDRLHPGTLMVATQVSWWPDVIF
FRSTDAGATWTRIWDWASYPNRTFRYKMDISSSPWLTFGANPQPPETTPKLGWMTESLEI
DPFDSNRMMYGTGATLYGTEDLLKWDTGGQFTIKPMVRGLEETAVLDLISPPSGAPLVSG
LGDIGGFRHTDLAAVPPMMFTSPVFTSTTSLDYAETKPAVMVRAGNFTDADRPSDSHVAF
STDGGANWFQGTEPGGINEGGTVAAAADGSRFVWAPKGVAVHRSTGFGTSWTASTGIPAG
AVVESDRVNPARFYGFGAGRFYASTDGGASFAATAATGLPATGNVKFKAVPGREGDIWLA
GGDTAAGGTSGIWHSTDGGASFTKLSGVTSAVNIGFGKAAPGRAYQALYAVATVGGVNGV
FRSDDTGASWVRINDDRHRYGNMGEAVTGDPRVYGRVYLGTNGRGILYADNGGTVPPDDT
TPPSRPGTPAASAITSSGATLTWTASTDDTAVTGYDVYREAGATDVKAGSSSSASFALTG
LAADTSHTYYVVARDGAGNSSTASGPVTFRTAAGPVGGGCAAAYKVTNSWPGGFQGEVTV
KNTGTSAISAWTVKWSFPDGQTITQLWSGVHTQTGADVTVGNAGWNGGLGGGASTAFGFG
GSWTGANGVPATVTCTAG
Download sequence
Identical sequences D2B2Y8
gi|271964015|ref|YP_003338211.1| 479432.Sros_2492 WP_012889213.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]