SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2BIP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2BIP7
Domain Number - Region: 7-23,73-99
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00272
Family Di-heme elbow motif 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2BIP7
Sequence length 105
Comment (tr|D2BIP7|D2BIP7_DEHMV) Uncharacterized protein {ECO:0000313|EMBL:ACZ62197.1} KW=Complete proteome OX=311424 OS=Dehalococcoides mccartyi (strain VS). GN=DhcVS_1080 OC=Dehalococcoidaceae; Dehalococcoides.
Sequence
MAYQDKEIQCADCGASFTFTASEQELYASRGYTNDPKRCVSCRQARKAERGGSTGGFGGM
SRGPARQMFQAVCAQCGQDTEVPFEPRQGRPVYCSNCYNRVKGGR
Download sequence
Identical sequences A0A076IBT1 A0A0C6EEU8 A0A0V8M2X9 D2BIP7 Q3Z6Z1
243164.DET1296 311424.DhcVS_1080 gi|57233900|ref|YP_182008.1| gi|270308467|ref|YP_003330525.1| WP_010936985.1.26930 WP_010936985.1.32090 WP_010936985.1.40429 WP_010936985.1.46065 WP_010936985.1.4711 WP_010936985.1.64064 WP_010936985.1.65481 WP_010936985.1.69666 WP_010936985.1.96037 WP_010936985.1.98386 gi|561113307|ref|YP_008856368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]