SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2BJP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2BJP5
Domain Number - Region: 44-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0167
Family Calponin-homology domain, CH-domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2BJP5
Sequence length 130
Comment (tr|D2BJP5|D2BJP5_DEHMV) Uncharacterized protein {ECO:0000313|EMBL:ACZ62545.1} KW=Complete proteome OX=311424 OS=Dehalococcoides mccartyi (strain VS). GN=DhcVS_1447 OC=Dehalococcoidaceae; Dehalococcoides.
Sequence
MACFLVVAGEAMVTTVVQKTVEKKEKHQDIKADNTSGISWGRKLGWLNKMLWGGTALLAL
EHVWHGEVVPWWPFLTAMENPADISPMLHEMATIGGAMSLTVTAIWAVMVLVADAKFKSS
VRANNIGAGA
Download sequence
Identical sequences D2BJP5
WP_012882678.1.64064 gi|270308815|ref|YP_003330873.1| 311424.DhcVS_1447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]