SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2GUS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2GUS4
Domain Number 1 Region: 12-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 2 Region: 828-1107
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000302
Family Rhodopsin-like 0.015
Further Details:      
 
Domain Number 3 Region: 135-311
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000185
Family Pentraxin (pentaxin) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2GUS4
Sequence length 1217
Comment (tr|D2GUS4|D2GUS4_AILME) Adhesion G protein-coupled receptor G6 {ECO:0000313|Ensembl:ENSAMEP00000012331} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_000412 OC=Ailuropoda.
Sequence
TVWGCANCRVILSNPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPN
CIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSL
RNQKVILPQTLDSYQVSVAKSVSIPELSAFTLCFEATKIGKEDHEWIAFSYSNASFTQLL
SFGKAKNGYFISISGSKCFLNSVLPVKDKEDIFTESFEQLCIIWNNSLGSVGVNFKRNYE
AVPCDSTISKVIPGNGKLLLGSSHNEMASLKGDIYNFRLWNFTMNSKVLSNLSCHVKGNV
VDWQNDFWNIPTLALKAESNLSCGSYLIPLPAAELANCADLGTLCQATIDSPSTTPPTVT
TNMPVTNRIDKQRNDGIVYRISIVIQNILRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNI
SFHLSTGEDKIKVKRSIVNDQRLVIWALLVYNATNNPNLEGKDIQQKLLKNNESLDEGLR
LYAVSVKQLDLCPADEDPKGFHWPLIPPSVYNLPCPGKQGFYASRTCNWDPANASVAYWG
LPDLSNCSNEANEVANQILNLTGDGQTLSSANITSIVEQVKRIVNKEENIDITLGSTLMN
IFSNILTSPDSDLLESSSEALKTIDELAFKIDLNSISRVNITTRNLALGVSSLSPGTNEI
SNFSISLPSNNESYFQMDFESGQMDPLASVILPPNLLENLSQEDSVLVKRAQFTFFNKTG
LFQDVETKKGTLVSYVMACSIGNITIQGLKDPVRIKIKHTRNQAVPHPICAFWDLNKNEG
SGFWNTSGCVAHRDSDESETVCLCNHLTHFGVLMDLQGTASQIDARNTKLLTFITYIGCG
VSAIFSAATLLTYVAFEKLRRDYPSKILMNLSTALLFLNLLFLLDGWITSFHVDGLCTAI
AALLHFFLLATFTWMGLEAIHMYIALVKVFNTYIRRYILKFCIIGWGLPALIVSIVLASR
NQNEVYGKESYGKEQGDEFCWIQDPVIFYVTCAGYFGVMFFLNVAMFIVVMVQICGRNGK
RSNRTLREEVLRNLRSVVSLTFLLGMTWGFAFFAWGSLNVPFMYLFSIFNSLQGFFIFIF
HCAMKENVQKQWRRHLCCGRFRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYL
TSKSKSSSTTYFKRNSHTDNASMDKSSSKLTHAVGEQTSIIPVHQVIDKVKGYCNAHSDN
FYKNIIMSDTFSHSTKF
Download sequence
Identical sequences D2GUS4
ENSAMEP00000012331 ENSAMEP00000012331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]