SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2GYK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2GYK2
Domain Number 1 Region: 172-239
Classification Level Classification E-value
Superfamily Homeodomain-like 1.33e-19
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 47-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000054
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 18-45
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000167
Family LIM domain 0.015
Further Details:      
 
Weak hits

Sequence:  D2GYK2
Domain Number - Region: 108-136
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0174
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2GYK2
Sequence length 368
Comment (tr|D2GYK2|D2GYK2_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB24442.1} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_002084 OC=Ailuropoda.
Sequence
AVDRRPSIAAVGRAVSPKSVCEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCF
YRDKKLYCKYDYEKLFAVKCGGCFEAVAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDE
FVLKEGQLLCKGDYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGATEDGKDHKR
PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLA
RRQQQQQQDQQNTQRLSSAQTNGSGNAGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQ
GLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYS
MQNSYFTS
Download sequence
Identical sequences D2GYK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]