SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2H171 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2H171
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily EF-hand 3.68e-43
Family Calmodulin-like 0.0000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2H171
Sequence length 160
Comment (tr|D2H171|D2H171_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB25076.1} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_003245 OC=Ailuropoda.
Sequence
YKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALS
VTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVD
RIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Download sequence
Identical sequences A0A091H5H0 D2H171 F1MZQ0 F1PET6 F6WGJ6 G1N134 G9KCV0 H0XKR7 L5K7C3
ENSCAFP00000029561 XP_010135997.1.100080 9615.ENSCAFP00000029561 9823.ENSSSCP00000006103 9823.ENSSSCP00000006105 ENSPVAP00000003345 ENSPVAP00000003345 ENSSSCP00000006105 ENSOGAP00000016707 ENSCJAP00000037900 ENSSSCP00000006105 ENSBTAP00000011496 ENSMGAP00000005178 ENSBTAP00000011496 ENSMGAP00000005178 ENSOGAP00000016707 ENSCAFP00000029561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]