SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2H591 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2H591
Domain Number 1 Region: 6-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-36
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 2 Region: 268-388
Classification Level Classification E-value
Superfamily TIMP-like 3.77e-36
Family Netrin-like domain (NTR/C345C module) 0.00021
Further Details:      
 
Domain Number 3 Region: 127-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2H591
Sequence length 388
Comment (tr|D2H591|D2H591_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB18265.1} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_005045 OC=Ailuropoda.
Sequence
RPVFTCGGILTGESGFIGSEGFPGVYPPNSKCTWKITVPEGKVVVLNFRFIDLESDNLCR
YDFVDVYNGHTNGQRIGRFCGTFRPGALVSSGNKMMVQMISDANTAGNGFMAMFSAAEPN
ERGDQYCGGRLERPSGSFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELKFEKFDVERDNY
CRYDFVAVFNGGEVNDAKRIGKYCGDSPPAPIVSERNELLIQFLSDLSLTADGFIGHYKF
RPKKLPTTTAPPVTTTFPATTGVKPTVALCQQKCRRTGTLESNYCSSNFVLAGTVITTVT
RGGSLHATVSIINIYKEGNLAIQQAGKNMSAKVTVVCKQCPLLRRGLNYIIMGQVGEDGR
GKIMPNSFIMMFKTKNQKLLDALKNKQC
Download sequence
Identical sequences D2H591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]