SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2HFQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2HFQ0
Domain Number 1 Region: 297-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 409-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-24
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 3 Region: 465-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 510-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 246-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 112-163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000307
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2HFQ0
Sequence length 611
Comment (tr|D2HFQ0|D2HFQ0_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB29848.1} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_009738 OC=Ailuropoda.
Sequence
QGCVTFEDVTIYFSQEEWGLLDEAQRLLYCDVMLENFALIASLGLTAFRSHIVAQLQMGA
EPWVPDRVDMTSAMARGVYSGPVSGFCCGTEGECNVSAKGVSQDRKLKAALSNQKDYSCD
TCGLHLKDILHLTEHQATHPRQKPDVCEASGRGFKSSANLHQHQNVDKPVRRDEDRSSLV
RSCRDDTSMEPFTVREDGKAFVGETATSGFLQHRVAHRVEEPPQSTGVQSLNKCREFGST
LSDKPTPVQHQRIHTGEMPYECNKCGIFFSHASSLFQHQRDHNRGKPYECCECGKFFSQH
SSLVKHQRVHTGESPHVCSECGKFFSRSSNLIQHKRVHTGEKPYECSECGKFFSQRSNLI
HHKRVHTGKSAHECSECGKSFNCNSSLIKHWRVHTGERPYKCNECGKFFSHIASLIQHQI
VHTGERPYGCSECGKAFSRSSDLMKHQRVHTGERPYECIECGKLFSQSSSLNSHRRLHTG
ERPYQCPECGKFFNQSSSLNNHRRLHTGERPYECLECGKTFRQRSNLRQHQKVHKPDRPY
KCGECGKAFSQRPTLVRHQKIHTRERSAENVHLPPAQRCAVEISSENSLYEGAISQRLNL
VHPSVHTGQIP
Download sequence
Identical sequences D2HFQ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]