SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2HKG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2HKG5
Domain Number 1 Region: 8-49
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000523
Family Somatomedin B domain 0.0051
Further Details:      
 
Domain Number 2 Region: 47-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000602
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2HKG5
Sequence length 237
Comment (tr|D2HKG5|D2HKG5_AILME) Somatomedin B and thrombospondin type 1 domain containing {ECO:0000313|Ensembl:ENSAMEP00000006346} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_011872 OC=Ailuropoda.
Sequence
CCPGRDAACFARGWRLDRVYGTCFCDQACRLTGDCCFDYARACPARPCIVGEWSPWSGCA
DQCKPAARVRRRPVQQEPRNGGAPCPPLEERAGCLDYSTARGQDCGHSFVPAFITTSAFN
KERTRHATSPQWSTDTEDTGYCMEFKTESLTHHCATENRPLTRWMQYLREGYTVCVDCQP
PAMNSESLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences D2HKG5
ENSAMEP00000006346 ENSAMEP00000006346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]