SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2HQM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2HQM1
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 1e-21
Family Pyrin domain, PYD 0.0000321
Further Details:      
 
Domain Number 2 Region: 108-192
Classification Level Classification E-value
Superfamily DEATH domain 1.13e-17
Family Caspase recruitment domain, CARD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2HQM1
Sequence length 194
Comment (tr|D2HQM1|D2HQM1_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB28280.1, ECO:0000313|Ensembl:ENSAMEP00000007547} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_014201 OC=Ailuropoda.
Sequence
MGCTRDAILDALENLTADEFKKFKLKLLSVPLREGYGRIPRGTLMSMDAMDLTDKLVSFY
LEKYSAELTAVVLREIGMQETAEKLQEITCKGPAPGPAGIQDHQTAAKPGLHFVDQHRAA
LVARVTDVDGVLDALYGNVLSEEQYGAVRAEPTNPMKMRKLLGFAPAWNTTCKDLLLQAL
RNTHPYLVADLEKS
Download sequence
Identical sequences D2HQM1
ENSAMEP00000007547 XP_002924797.1.58354 ENSAMEP00000007547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]