SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2HRP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2HRP3
Domain Number 1 Region: 613-907
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-83
Family Protein kinases, catalytic subunit 0.000000000528
Further Details:      
 
Domain Number 2 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.93e-75
Family Ephrin receptor ligand binding domain 0.000000913
Further Details:      
 
Domain Number 3 Region: 328-532
Classification Level Classification E-value
Superfamily Fibronectin type III 4.37e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 910-981
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.35e-20
Family SAM (sterile alpha motif) domain 0.0000452
Further Details:      
 
Domain Number 5 Region: 257-320,366-382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000173
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2HRP3
Sequence length 986
Comment (tr|D2HRP3|D2HRP3_AILME) Receptor protein-tyrosine kinase {ECO:0000256|SAAS:SAAS00602636} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_014673 OC=Ailuropoda.
Sequence
MAGIFYFVLFSFLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIANPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPNQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRESQFAKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERNGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDFSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPSPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQDDLARIGITAVT
HQNKILSSVQAMRTQMQQIHGRMVPV
Download sequence
Identical sequences D2HRP3
ENSAMEP00000008034 XP_002925223.1.58354 ENSAMEP00000008034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]