SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2HXX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2HXX2
Domain Number 1 Region: 25-159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-35
Family Galectin (animal S-lectin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2HXX2
Sequence length 160
Comment (tr|D2HXX2|D2HXX2_AILME) Galectin {ECO:0000256|RuleBase:RU102079} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_017516 OC=Ailuropoda.
Sequence
KLDDGHLNNSLGSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLT
CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEH
PRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
Download sequence
Identical sequences D2HXX2 G7NA66 G7PMB6 G9L0M8 L8IVK8
ENSFCAP00000001122 9615.ENSCAFP00000004729 9685.ENSFCAP00000001122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]