SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2HXZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2HXZ3
Domain Number 1 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-23
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 7 Region: 218-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 8 Region: 593-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 10 Region: 166-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000285
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 11 Region: 107-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000037
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 12 Region: 56-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000315
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2HXZ3
Sequence length 654
Comment (tr|D2HXZ3|D2HXZ3_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB19515.1} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_017541 OC=Ailuropoda.
Sequence
VFQGAVSFKDVTVDFSREEWQQLDLAQKSLYRDVMLENYFNLISVENLDKIIGCGNIFTH
MNSHTETNACEYNQYKKLLSHKQALTQHQGIHTGENLNLFSDYVKIFTQKPHLFGHQSIY
TEEKQHEYSKCEIVFTQKPQLAVPQKASIGRKPCTRTEYEKDLSLKSNHEKTHTEENHCK
CSGYGKACIQKSDLFRCQGIHIGEKPYECSECGKNVSQNSNLNEHKKIHTGEKHFECTEC
GKAFTRKSTLSMHQKIHTGEKPYVCAECGKAFIRKSHFITHERIHTGEKPYECRDCGKSF
IKKSQLHVHQRIHTGENPFICTECGKVFTHKTNLIIHQKIHTGERPYICTECAKAFTDRS
NLIKHQKIHTGEKPYKCSDCGKSFTWKSRLRIHQKCHTGERHYECSECGKAFIQKSTLSM
HQRIHRGEKPYVCTECGKAFFHKSHFITHERIHTGEKPYECSDCGKSFTKKSQLHVHQQI
HTGEKPYRCAECGKAFTDRSNLFTHQKIHTGEKPYKCSECGKAFTRKSGLHIHQQSHTGE
RHYECSECGKAFARKSTLIMHQRIHTGEKPYICTECGKSFIQKSHLNRHRRIHTGEKPYE
CSDCGKAFIKKSQLHEHHRIHTGEKPFICAECGKAFTIRSNLIKHQKIHAKQKP
Download sequence
Identical sequences D2HXZ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]