SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2HZ10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2HZ10
Domain Number 1 Region: 243-284
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000209
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2HZ10
Sequence length 285
Comment (tr|D2HZ10|D2HZ10_AILME) Neuralized E3 ubiquitin protein ligase 2 {ECO:0000313|Ensembl:ENSAMEP00000013267} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_018013 OC=Ailuropoda.
Sequence
MAAVSDPVDLGAAWRSARPEPPPTRFHQVHGANIRVDPSGTRATRVESFAHGVCFSREPL
APGQVFLVEIEEKELGWCGHLRLGLTALDPSTLAAVPEFSLPDLVSLGHTWVFAITRHHN
RVPREDRPEAEALAPSRPPALLVEPYLCIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNV
LPPTARRSRLGVLFCPRPDGTADMHIVINGEDMGPSARGLPAAQPLYAVVDVFASTKSVR
LVQLEYGLPSLQTLCRLVIQRSVVHRLAIDGLHLPKGLKDFCKYE
Download sequence
Identical sequences D2HZ10
ENSAMEP00000013267 ENSAMEP00000013267 XP_002928099.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]