SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2NUH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2NUH5
Domain Number 1 Region: 771-1349
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 6e-203
Family Myeloperoxidase-like 0.000000000504
Further Details:      
 
Domain Number 2 Region: 37-240
Classification Level Classification E-value
Superfamily L domain-like 7.18e-37
Family Ngr ectodomain-like 0.0073
Further Details:      
 
Domain Number 3 Region: 235-327
Classification Level Classification E-value
Superfamily Immunoglobulin 4.02e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 455-551
Classification Level Classification E-value
Superfamily Immunoglobulin 1.79e-18
Family I set domains 0.0077
Further Details:      
 
Domain Number 5 Region: 552-645
Classification Level Classification E-value
Superfamily Immunoglobulin 9.06e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 364-462
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-16
Family I set domains 0.022
Further Details:      
 
Domain Number 7 Region: 1463-1524
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000324
Family VWC domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2NUH5
Sequence length 1527
Comment (tr|D2NUH5|D2NUH5_DROME) GH13031p {ECO:0000313|EMBL:ADB25334.1} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Pxn-RE OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MRFMLLMLQLLGLLLLLAGGVQSVYCPAGCTCLERTVRCIRAKLSAVPKLPQDTQTLDLR
FNHIEELPANAFSGLAQLTTLFLNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIF
QRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLD
GNAIDCNCGVYSLWRRWHLDVQRQLVSISLTCAAPQMLQNQGFSSLGEHHFKCAKPQFLV
APQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSADTS
DMGIYQCIARNEMGALRSQPVRLVVNGGNHPLDSPIDARSNQVWADAGTPMHGATPLPSP
LPSPPHFTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQWFVNGRQLLQSTPSLQLQANG
SLILLQPNQLSAGTYRCEARNSLGSVQATARIELKELPEILTAPQSQTIKLGKAFVLECD
ADGNPLPTIDWQLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSV
EATIKVERSQSPPQLAIEPSNLVAITGTTIELPCQADQPEDGLQISWRHDGRLIDPNVQL
AEKYQISGAGSLFVKNVTIPDGGRYECQLKNQFGRASASALVTIRNNVDLAPGDRYVRIA
FAEAAKEIDLAINNTLDMLFSNRSDKAPPNYGELLRVFRFPTGEARQLARAAEIYERTLV
NIRKHVQEGDNLTMKSEEYEFRDLLSREHLHLVAELSGCMEHREMPNCTDMCFHSRYRSI
DGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVA
TKEITPDARITHMVMQWGQFLDHDLDHAIPSVSSESWDGIDCKKSCEMAPPCYPIEVPPN
DPRVRNRRCIDVVRSSAICGSGMTSLFFDSVQHREQINQLTSYIDASQVYGYSTAFAQEL
RNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRVNEQVGLL
AMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGME
MMGEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGHLLLHKAFFAP
WRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDLAAINIQRGRDH
GMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEG
GKVGPLFQCLLVEQFRRLRDGDRLYYENPGVFSPEQLTQIKQANFGRVLCDVGDNFDQVT
ENVFILAKHQGGYKKCEDIIGINLYLWQECGRCNSPPAIFDSYIPQTYTKRSNRQKRDLG
KENDEVATAESYDSPLESLYDVNEERVSGLEELIGSFQKELKKLHKKLRKLEDSCNSADS
EPVAQVVQLAAAPPQLVSKPKRSHCVDDKGTTRLNNEVWSPDVCTKCNCFHGQVNCLRER
CGEVSCPPGVDPLTPPEACCPHCPMVK
Download sequence
Identical sequences D2NUH5 Q9VZZ4
7227.FBpp0089216 FBpp0072827 FBpp0072828 FBpp0089205 FBpp0089215 FBpp0089216 NP_523891.2.81976 NP_995975.1.81976 NP_995976.1.81976 NP_995977.1.81976 FBpp0072828 FBpp0089205 FBpp0089215 FBpp0089216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]