SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2PTC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2PTC1
Domain Number 1 Region: 2-410
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.68e-71
Family Gtf glycosyltransferase 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2PTC1
Sequence length 412
Comment (tr|D2PTC1|D2PTC1_KRIFD) Glycosyl transferase family 28 {ECO:0000313|EMBL:ADB29437.1} KW=Complete proteome; Reference proteome OX=479435 OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399). GN=Kfla_0313 OC=Kribbella.
Sequence
MVGMGSRGDAQPMALLGAELTARGYDVEVALASDLAWIGTALGLRTTDLGFSARDFLDSE
QGRTWLAAGDVASYVRWLLAFKQEIAEELQARLVRLTDGADVVVSGTATELECAVIAEAR
GVPYVAVHHVPLRSNSAFPHLLVSTEILSPEQNRQTYLDVDRANWPVFEPLLNAFRGQLG
LPPTADNTATRLERADSLELQAYSRFLLPELADWSPRRPLTGFITPTESQRAVLSGARGD
RDLDAWLAAGDPPVYFGFGSMPVLDPPAALTLIEKVSATLGVRALVGLRGATSSNPAVRV
VWELDHEAVLPRCRAAVHHGGAGTTAVSLRAGLPTVVCAVFADQPFWGALLHRRDLGSTL
PFTGLAELPLLAALEPLLTSQARARAAAMSQQLHSENGSAQAADAFEHALGE
Download sequence
Identical sequences D2PTC1
gi|284028305|ref|YP_003378236.1| WP_012917994.1.69711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]