SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2RVB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2RVB9
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily Vng1086c-like 8.24e-23
Family Vng1086c-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2RVB9
Sequence length 80
Comment (tr|D2RVB9|D2RVB9_HALTV) Metal-binding protein-like protein {ECO:0000313|EMBL:ADB61320.1} KW=Complete proteome; Reference proteome OX=543526 OS=VKM B-1734) (Halococcus turkmenicus). GN=Htur_2442 OC=Haloterrigena.
Sequence
MVMKKQELIHLHGLLAEVSNQCAEWDDCTIDLEEYESRGIRPTSIHKSKTDHKAAVFALA
GGITKNMREGEQEAVAATAD
Download sequence
Identical sequences D2RVB9 M0C3V7
gi|284165714|ref|YP_003403993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]