SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2S7L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2S7L4
Domain Number 1 Region: 8-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.26e-17
Family GntR-like transcriptional regulators 0.015
Further Details:      
 
Domain Number 2 Region: 81-157
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000000549
Family GntR ligand-binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2S7L4
Sequence length 174
Comment (tr|D2S7L4|D2S7L4_GEOOG) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ADB75473.1} KW=Complete proteome; Reference proteome OX=526225 OS=G-20). GN=Gobs_2845 OC=Geodermatophilus.
Sequence
MWQVVTTFRPHTMQVAVLQELRRRIHDGELRPGTVIRVDAVAGALGVSRMPVREARMILE
GEGLVTHRPHVGFTVPSLTAEELEEIYFIRALLEDEALRRALENTTDADRAAAREACRAA
EEALHHGQVNAFSDNGRRFHEALLVPCHMPRLLRQLAGAQLGTCPPTDTPTGRP
Download sequence
Identical sequences D2S7L4
WP_012948906.1.76031 gi|284991290|ref|YP_003409844.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]