SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2SBV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2SBV0
Domain Number 1 Region: 84-224
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.25e-21
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 11-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.58e-19
Family GntR-like transcriptional regulators 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2SBV0
Sequence length 238
Comment (tr|D2SBV0|D2SBV0_GEOOG) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ADB76207.1} KW=Complete proteome; Reference proteome OX=526225 OS=G-20). GN=Gobs_3621 OC=Geodermatophilus.
Sequence
MTADSRAEGTEEVSKADQVHRQLRTEIELGELAPGTPLSELSLVGRTGASRTPVREALRR
LAAEGLVDLVPRQGARVSRVSARSVRDLFEFRSLLEPAAVRQATEAAATDPALHRTFAEL
REAIAGVLERDPSTARSRSFYELADRFDWAVIGATRNEHLRRTIAELRPHTARLRNLSHL
DPQRVEVSVGEHLAVCDALLAGDADGAATALAGHLTRSLETIFRNLAHGPGEGVDLLG
Download sequence
Identical sequences D2SBV0
WP_012949632.1.76031 gi|284992024|ref|YP_003410578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]