SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2XNI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2XNI8
Domain Number 1 Region: 164-447
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-40
Family Nuclear receptor ligand-binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 18-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-27
Family Nuclear receptor 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2XNI8
Sequence length 465
Comment (tr|D2XNI8|D2XNI8_SACKO) PPAR-like protein {ECO:0000313|EMBL:ADB22618.1} OX=10224 OS=Saccoglossus kowalevskii (Acorn worm). GN= OC=Saccoglossus.
Sequence
MASSKIKNRKSRPRQASKYVCAVCGDVSTGLHYGVHSCEGCKGFFRRTIRMSLLYEPCPY
RDSDPCTINISTRNKCQFCRYKKCLDVGMSAKEVKMGRIPLVEKKKILQELEKRASLMTA
PPTGTLTPTPSPSTSLVSSDDHGCSQSPSFPLESPVQTPMRFFSAENEELIDNLYSAYSQ
IFQEALKFKKYRKSPSENKESTDVNIEVNESMLSSPENGQDQERSRDPEAFIELTEFKDV
IMCGHCVAQAQIKLAASFVRTLNDFQDLDISDQVILLKHGAYELSMMVNSYRLADPSRLV
LYELGVYINTDRMINHFSSLINMNMKEITEPKIKFGQRVIQLNMTDQEMALMCALVLFAP
DRDGIQDRAKVELFQEKITSALEYTIQQTRPGNRVLLPKILNLLVELRTHSVQHIKHLRF
AYRPDSKMRNMVGLEFELPPLLREVFGFESGTDFEDDAEDYVLPI
Download sequence
Identical sequences D2XNI8
NP_001164713.1.86028 Sakowv30026938m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]